Retatrutide 12mg Product Overview
Retatrutide 12mg is a research product containing the investigational peptide retatrutide, also known as LY3437943. Retatrutide is designed as a triple agonist of GIPR, GLP-1R, and GCGR, giving it a distinct pharmacological profile compared with peptide compounds that target only one or two of these receptors.
The 12mg designation refers to the labeled product quantity. It should not be interpreted as a statement about molecular purity, concentration, formulation, or the amount of active peptide in a specific preparation unless those characteristics are confirmed by batch-specific documentation.
From a research perspective, Retatrutide is especially interesting because it combines three receptor activities within a single engineered peptide molecule. This provides researchers with a model for investigating how GIP, GLP-1, and glucagon signaling pathways can be studied together.
Primary Research Classification
Retatrutide 12mg can be classified as:
- Synthetic metabolic research peptide
- Triple receptor agonist
- GIP receptor research agonist
- GLP-1 receptor research agonist
- Glucagon receptor research agonist
- Lipid-modified peptide
- Incretin-pathway research compound
- Multi-receptor peptide pharmacology material
Its three primary molecular targets are GIPR, GLP-1R, and GCGR. These receptors belong to the class B family of G protein-coupled receptors and participate in signaling pathways associated with metabolic regulation.
Scientific Background
Retatrutide is a 39-residue synthetic peptide developed to engage three distinct hormone receptor systems.
The registered peptide sequence is:
YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS
The molecule contains several structural modifications that distinguish it from a simple unmodified peptide sequence. These include substitutions involving α-aminoisobutyric acid (Aib) and α-methyl-leucine, together with a modified lysine residue used for lipid conjugation. Retatrutide also contains a C-terminal amide.
These structural modifications are relevant to peptide research because changes in amino-acid composition, molecular conformation, lipidation, and terminal chemistry can influence receptor interactions, enzymatic stability, protein binding, and pharmacokinetic characteristics.
Public chemical databases report a molecular formula of C₂₂₁H₃₄₂N₄₆O₆₈ and a molecular weight of approximately 4731 g/mol for retatrutide.
Molecular Structure and Peptide Engineering
One of the most important research features of Retatrutide is its engineered molecular structure.
The peptide incorporates modifications intended to produce a particular combination of receptor activity and molecular behavior. Its lipid-containing side chain is attached through a modified lysine residue and linker system.
This makes Retatrutide relevant to research into several aspects of peptide design:
- Amino-acid substitution
- Peptide conformation
- Lipidation
- Peptide-protein interactions
- Receptor binding
- Enzymatic stability
- Molecular persistence
- Multi-receptor agonism
The molecule therefore represents more than a conventional peptide sequence. It provides a research model for examining how structural engineering can influence interactions with several related GPCR targets.
Mechanism of Research Interest
GIP Receptor
The glucose-dependent insulinotropic polypeptide receptor, or GIPR, is one of Retatrutide’s three primary targets.
GIPR is a class B GPCR. Activation of this receptor can stimulate intracellular signaling involving adenylate cyclase and cyclic AMP (cAMP).
Researchers can therefore investigate Retatrutide in experimental systems designed to evaluate GIPR activation, second-messenger responses, receptor pharmacology, and downstream cellular signaling.
GLP-1 Receptor
Retatrutide also activates the GLP-1 receptor (GLP-1R).
GLP-1R is another class B GPCR associated with cAMP-dependent intracellular signaling. Research into GLP-1R commonly examines signaling networks involving protein kinase A (PKA), Epac proteins, and other downstream effectors.
Including GLP-1R activity within a three-receptor molecule makes Retatrutide useful for comparative studies involving single-, dual-, and triple-receptor agonists.
Glucagon Receptor
The third target is the glucagon receptor (GCGR).
GCGR signaling is associated with intracellular pathways involved in metabolic regulation, including cAMP-mediated signaling. The GCGR component distinguishes Retatrutide from GLP-1-only and GLP-1/GIP dual-agonist research compounds.
Published research describes Retatrutide as a single molecule capable of activating GIP, GLP-1, and glucagon receptors.
Integrated Multi-Receptor Signaling
The defining scientific feature of Retatrutide is the ability to study three receptor pathways through one engineered peptide.
This creates research opportunities involving:
- GIPR signaling
- GLP-1R signaling
- GCGR signaling
- cAMP pathways
- GPCR pharmacology
- Receptor selectivity
- Receptor-ligand interactions
- Metabolic signaling networks
- Peptide structure-function relationships
Rather than treating each pathway as completely independent, researchers can investigate how simultaneous receptor activity may influence cellular and physiological signaling.
Key Research Applications
1. Triple-Receptor Pharmacology
Retatrutide provides a model for investigating simultaneous activation of GIPR, GLP-1R, and GCGR.
2. Incretin Signaling Research
The molecule can be studied in research systems examining GIP and GLP-1 receptor biology and the relationship between these pathways.
3. Glucagon Receptor Research
Its GCGR activity makes Retatrutide relevant to research into glucagon-associated signaling and metabolic pathway regulation.
4. Peptide Engineering
The molecule’s modified sequence and lipid-containing structure make it useful for studying how molecular engineering influences peptide behavior.
5. Receptor Structure-Function Studies
Researchers can examine how sequence modifications and molecular architecture affect interactions with multiple class B GPCRs.
6. Comparative Metabolic Research
Retatrutide can serve as a research reference when comparing single, dual, and triple receptor agonist strategies.
7. Analytical Research
The molecule’s modified structure also provides opportunities for analytical studies involving chromatographic separation, mass spectrometry, peptide characterization, and degradation or stability investigations.
Technical Specifications
| Specification | Retatrutide |
|---|---|
| Product | Retatrutide 12mg |
| Development code | LY3437943 |
| Classification | Synthetic peptide |
| Peptide length | 39 residues |
| Primary targets | GIPR, GLP-1R, GCGR |
| Molecular formula | C₂₂₁H₃₄₂N₄₆O₆₈ |
| Approx. molecular weight | 4731 g/mol |
| CAS Registry Number | 2381089-83-2 |
| C-terminal modification | Amidated |
| Key structural features | Aib, α-methyl-leucine, lipid conjugation |
| Research status | Investigational |
The molecular and structural information above is based on publicly available chemical and regulatory records.
Product-specific information should be verified from the applicable Certificate of Analysis or product documentation.
The 12mg product quantity should also be confirmed against the product label and batch documentation. No assumption should be made about purity, concentration, formulation, or the presence of additional excipients without supporting documentation.
Storage and Handling
Storage requirements for Retatrutide 12mg depend on the specific formulation, packaging, manufacturing process, and batch specifications.
Because product-specific storage conditions have not been provided for this page, researchers should consult the applicable product documentation rather than relying on generic peptide-storage assumptions.
Product-specific information should be verified from the applicable Certificate of Analysis or product documentation.
This page does not provide reconstitution procedures, administration instructions, or human or animal dosing information.
Why Researchers Choose Peptide Sciences
Researchers evaluating Retatrutide 12mg from Peptide Sciences should focus on objective, product-specific information when assessing research materials.
Relevant documentation may include:
- Peptide identity
- Batch or lot information
- Certificate of Analysis
- Analytical characterization
- HPLC results where supplied
- Mass spectrometry data where supplied
- Reported purity where documented
- Formulation information
- Product-specific handling requirements
The scientific identity of retatrutide does not independently establish the characteristics of a particular commercial batch.
This distinction is central to responsible peptide science. Researchers should separate published information about the Retatrutide molecule from the analytical characteristics of the specific material being evaluated.
When comparing Peptide Sciences with other research suppliers, batch-level documentation and verifiable analytical information are more useful than unsupported general statements about product quality.
Research Evidence and Limitations
Retatrutide has been extensively investigated as a triple GIP, GLP-1, and glucagon receptor agonist. Research has progressed from preclinical pharmacology into clinical investigation, including studies evaluating metabolic endpoints.
However, research findings should always be interpreted in the context of the experimental model.
Results may differ according to:
- Species
- Cell type
- Receptor expression
- Experimental system
- Exposure conditions
- Assay methodology
- Study endpoint
- Molecular formulation
Clinical research findings should not automatically be generalized to unrelated laboratory systems. Likewise, results from cell or animal experiments should not be presented as established outcomes in humans.
For researchers using Retatrutide 12mg, careful experimental design and appropriate analytical controls remain essential.
Laboratory Research Use Only
Laboratory Research Use Only.
Retatrutide 12mg is presented for scientific and laboratory research purposes only. This product description does not provide medical advice, treatment recommendations, human or animal dosing instructions, administration procedures, or disease-treatment claims.
Researchers are responsible for determining whether this material is appropriate for their intended experimental application and for complying with applicable laboratory, institutional, safety, and regulatory requirements.
